Lineage for d4hdca_ (4hdc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872882Species Staphylococcus aureus [TaxId:158879] [224890] (4 PDB entries)
  8. 2872889Domain d4hdca_: 4hdc A: [222525]
    automated match to d2ccka_
    complexed with 13y

Details for d4hdca_

PDB Entry: 4hdc (more details), 2.05 Å

PDB Description: Discovery of Selective and Potent Inhibitors of Gram-positive Bacterial Thymidylate Kinase (TMK: Compound 41)
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4hdca_:

Sequence, based on SEQRES records: (download)

>d4hdca_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikyleki

Sequence, based on observed residues (ATOM records): (download)

>d4hdca_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriidqedlkfhekviegyqeiihnesqrfksvnadqplenv
vedtyqtiikyleki

SCOPe Domain Coordinates for d4hdca_:

Click to download the PDB-style file with coordinates for d4hdca_.
(The format of our PDB-style files is described here.)

Timeline for d4hdca_: