SCOPe 2.08: Domain d4hdca_: 4hdc A:

Lineage for d4hdca_ (4hdc A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [224890] (4 PDB entries)

8. Domain d4hdca_: 4hdc A: [222525]
   automated match to d2ccka_
   complexed with 13y

Details for d4hdca_

PDB Entry: 4hdc, 2.05 Å

PDB Description: Discovery of Selective and Potent Inhibitors of Gram-positive Bacterial Thymidylate Kinase (TMK: Compound 41)

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4hdca_:

Sequence, based on SEQRES records:

>d4hdca_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikyleki

Sequence, based on observed residues (ATOM records):

>d4hdca_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriidqedlkfhekviegyqeiihnesqrfksvnadqplenv
vedtyqtiikyleki

Timeline for d4hdca_:

• d4hdca_ first appeared in SCOPe 2.03
  
• d4hdca_ appears in SCOPe 2.07