SCOPe 2.05: Domain d4hd9a2: 4hd9 A:91-203

Lineage for d4hd9a2 (4hd9 A:91-203)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (27 PDB entries)

8. Domain d4hd9a2: 4hd9 A:91-203 [222522]
   Other proteins in same PDB: d4hd9a1
   automated match to d1bqsa2
   complexed with nag

Details for d4hd9a2

PDB Entry: 4hd9, 1.7 Å

PDB Description: crystal structure of native human madcam-1 d1d2 domain

PDB Compounds: (A:) Mucosal addressin cell adhesion molecule 1

SCOPe Domain Sequences for d4hd9a2:

Sequence, based on SEQRES records:

>d4hd9a2 b.1.1.4 (A:91-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvlh

Sequence, based on observed residues (ATOM records):

>d4hd9a2 b.1.1.4 (A:91-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvlh

Timeline for d4hd9a2:

• d4hd9a2 first appeared in SCOPe 2.03
  
• d4hd9a2 appears in SCOPe 2.04
  
• d4hd9a2 appears in SCOPe 2.06
  
• d4hd9a2 appears in the current release, SCOPe 2.08