Lineage for d4hd9a2 (4hd9 A:91-203)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753968Protein automated matches [190803] (3 species)
    not a true protein
  7. 2753969Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. 2753974Domain d4hd9a2: 4hd9 A:91-203 [222522]
    Other proteins in same PDB: d4hd9a1
    automated match to d1bqsa2
    complexed with nag

Details for d4hd9a2

PDB Entry: 4hd9 (more details), 1.7 Å

PDB Description: crystal structure of native human madcam-1 d1d2 domain
PDB Compounds: (A:) Mucosal addressin cell adhesion molecule 1

SCOPe Domain Sequences for d4hd9a2:

Sequence, based on SEQRES records: (download)

>d4hd9a2 b.1.1.4 (A:91-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvlh

Sequence, based on observed residues (ATOM records): (download)

>d4hd9a2 b.1.1.4 (A:91-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvlh

SCOPe Domain Coordinates for d4hd9a2:

Click to download the PDB-style file with coordinates for d4hd9a2.
(The format of our PDB-style files is described here.)

Timeline for d4hd9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hd9a1