Lineage for d4hcrb2 (4hcr B:91-202)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295367Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1295762Protein automated matches [190803] (1 species)
    not a true protein
  7. 1295763Species Human (Homo sapiens) [TaxId:9606] [188070] (21 PDB entries)
  8. 1295778Domain d4hcrb2: 4hcr B:91-202 [222516]
    Other proteins in same PDB: d4hcra1, d4hcrb1, d4hcrl1, d4hcrl2, d4hcrn1, d4hcrn2
    automated match to d1bqsa2

Details for d4hcrb2

PDB Entry: 4hcr (more details), 2.3 Å

PDB Description: Crystal structure of human MAdCAM-1 D1D2 complexed with Fab PF-547659
PDB Compounds: (B:) Mucosal addressin cell adhesion molecule 1

SCOPe Domain Sequences for d4hcrb2:

Sequence, based on SEQRES records: (download)

>d4hcrb2 b.1.1.4 (B:91-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvl

Sequence, based on observed residues (ATOM records): (download)

>d4hcrb2 b.1.1.4 (B:91-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeed
vlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvl

SCOPe Domain Coordinates for d4hcrb2:

Click to download the PDB-style file with coordinates for d4hcrb2.
(The format of our PDB-style files is described here.)

Timeline for d4hcrb2: