SCOPe 2.07: Domain d4hcra2: 4hcr A:91-202

Lineage for d4hcra2 (4hcr A:91-202)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (28 PDB entries)

8. Domain d4hcra2: 4hcr A:91-202 [222514]
   Other proteins in same PDB: d4hcra1, d4hcrb1, d4hcrl1, d4hcrl2, d4hcrn1, d4hcrn2
   automated match to d1bqsa2

Details for d4hcra2

PDB Entry: 4hcr, 2.3 Å

PDB Description: crystal structure of human madcam-1 d1d2 complexed with fab pf-547659

PDB Compounds: (A:) Mucosal addressin cell adhesion molecule 1

SCOPe Domain Sequences for d4hcra2:

Sequence, based on SEQRES records:

>d4hcra2 b.1.1.4 (A:91-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvl

Sequence, based on observed residues (ATOM records):

>d4hcra2 b.1.1.4 (A:91-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeed
vlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvl

Timeline for d4hcra2:

• d4hcra2 first appeared in SCOPe 2.03
  
• d4hcra2 appears in SCOPe 2.06
  
• d4hcra2 appears in the current release, SCOPe 2.08