![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein automated matches [190803] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries) |
![]() | Domain d4hcra2: 4hcr A:91-202 [222514] Other proteins in same PDB: d4hcra1, d4hcrb1, d4hcrh_, d4hcrl1, d4hcrl2, d4hcrm_, d4hcrn1, d4hcrn2 automated match to d1bqsa2 |
PDB Entry: 4hcr (more details), 2.3 Å
SCOPe Domain Sequences for d4hcra2:
Sequence, based on SEQRES records: (download)
>d4hcra2 b.1.1.4 (A:91-202) automated matches {Human (Homo sapiens) [TaxId: 9606]} afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvl
>d4hcra2 b.1.1.4 (A:91-202) automated matches {Human (Homo sapiens) [TaxId: 9606]} afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeed vlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvl
Timeline for d4hcra2: