SCOPe 2.04: Domain d4hcra1: 4hcr A:1-90

Lineage for d4hcra1 (4hcr A:1-90)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4hcra1: 4hcr A:1-90 [222513]
   Other proteins in same PDB: d4hcra2, d4hcrb2, d4hcrl2, d4hcrn2
   automated match to d1gsma1

Details for d4hcra1

PDB Entry: 4hcr, 2.3 Å

PDB Description: crystal structure of human madcam-1 d1d2 complexed with fab pf-547659

PDB Compounds: (A:) Mucosal addressin cell adhesion molecule 1

SCOPe Domain Sequences for d4hcra1:

Sequence; same for both SEQRES and ATOM records:

>d4hcra1 b.1.1.0 (A:1-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
naslsaagtrvcvgscggrtfqhtvqllvy

Timeline for d4hcra1:

• d4hcra1 first appeared in SCOPe 2.03
  
• d4hcra1 appears in SCOPe 2.05
  
• d4hcra1 appears in the current release, SCOPe 2.08