SCOPe 2.05: Domain d4hcqa2: 4hcq A:264-464

Lineage for d4hcqa2 (4hcq A:264-464)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (28 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [224870] (7 PDB entries)

8. Domain d4hcqa2: 4hcq A:264-464 [222512]
   Other proteins in same PDB: d4hcqa1
   automated match to d1g95a1
   complexed with co, gn1, mg

Details for d4hcqa2

PDB Entry: 4hcq, 2.6 Å

PDB Description: crystal structure of glmu from mycobacterium tuberculosis in complex with glucosamine-1-phosphate

PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4hcqa2:

Sequence, based on SEQRES records:

>d4hcqa2 b.81.1.0 (A:264-464) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvp
pgalavsagpqrnienwvqrk

Sequence, based on observed residues (ATOM records):

>d4hcqa2 b.81.1.0 (A:264-464) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvppgalavs
agpqrnienwvqrk

Timeline for d4hcqa2:

• d4hcqa2 first appeared in SCOPe 2.03
  
• d4hcqa2 appears in SCOPe 2.04
  
• d4hcqa2 appears in SCOPe 2.06
  
• d4hcqa2 appears in the current release, SCOPe 2.08