Lineage for d4hcqa2 (4hcq A:264-464)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069791Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2069792Protein automated matches [190967] (30 species)
    not a true protein
  7. 2069900Species Mycobacterium tuberculosis [TaxId:1773] [224870] (7 PDB entries)
  8. 2069907Domain d4hcqa2: 4hcq A:264-464 [222512]
    Other proteins in same PDB: d4hcqa1
    automated match to d1g95a1
    complexed with co, gn1, mg

Details for d4hcqa2

PDB Entry: 4hcq (more details), 2.6 Å

PDB Description: Crystal structure of GLMU from mycobacterium tuberculosis in complex with glucosamine-1-phosphate
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4hcqa2:

Sequence, based on SEQRES records: (download)

>d4hcqa2 b.81.1.0 (A:264-464) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvp
pgalavsagpqrnienwvqrk

Sequence, based on observed residues (ATOM records): (download)

>d4hcqa2 b.81.1.0 (A:264-464) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvppgalavs
agpqrnienwvqrk

SCOPe Domain Coordinates for d4hcqa2:

Click to download the PDB-style file with coordinates for d4hcqa2.
(The format of our PDB-style files is described here.)

Timeline for d4hcqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hcqa1