SCOPe 2.08: Domain d4hcob1: 4hco B:371-500

Lineage for d4hcob1 (4hco B:371-500)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (3 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102858] (28 PDB entries)

8. Domain d4hcob1: 4hco B:371-500 [222509]
   automated match to d3bzia1
   complexed with gol, imw

Details for d4hcob1

PDB Entry: 4hco, 2.75 Å

PDB Description: Human Plk1-PBD in complex with Thymoquinone at the phophopeptide binding site

PDB Compounds: (B:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d4hcob1:

Sequence; same for both SEQRES and ATOM records:

>d4hcob1 d.223.1.2 (B:371-500) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdn
svgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehl
lkaganitpr

Timeline for d4hcob1:

• d4hcob1 first appeared in SCOPe 2.03
  
• d4hcob1 appears in SCOPe 2.07