SCOPe 2.07: Domain d4hcnb1: 4hcn B:1-76

Lineage for d4hcnb1 (4hcn B:1-76)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (24 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (8 PDB entries)

8. Domain d4hcnb1: 4hcn B:1-76 [222506]
   Other proteins in same PDB: d4hcnb2
   automated match to d3dbhi_
   complexed with fmt, peg, po4

Details for d4hcnb1

PDB Entry: 4hcn, 2.6 Å

PDB Description: crystal structure of burkholderia pseudomallei effector protein chbp in complex with ubiquitin

PDB Compounds: (B:) Polyubiquitin

SCOPe Domain Sequences for d4hcnb1:

Sequence; same for both SEQRES and ATOM records:

>d4hcnb1 d.15.1.0 (B:1-76) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

Timeline for d4hcnb1:

• d4hcnb1 first appeared in SCOPe 2.03, called d4hcnb_
  
• d4hcnb1 appears in SCOPe 2.06