| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
| Protein automated matches [226997] (13 species) not a true protein |
| Species Agrobacterium tumefaciens [TaxId:176299] [226506] (6 PDB entries) |
| Domain d4hclb2: 4hcl B:127-382 [222505] Other proteins in same PDB: d4hcla1, d4hcla3, d4hclb1, d4hclb3 automated match to d1rvka1 complexed with llh, mg, pg4 |
PDB Entry: 4hcl (more details), 1.8 Å
SCOPe Domain Sequences for d4hclb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hclb2 c.1.11.2 (B:127-382) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswapdvkmd
lkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqslssykwl
sdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlaeafgmec
evhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvhvpdrpg
lgedidftfidnnrvr
Timeline for d4hclb2: