Lineage for d4hclb1 (4hcl B:1-126)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2554790Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries)
  8. 2554798Domain d4hclb1: 4hcl B:1-126 [222504]
    Other proteins in same PDB: d4hcla2, d4hcla3, d4hclb2, d4hclb3
    automated match to d1rvka2
    complexed with llh, mg, pg4

Details for d4hclb1

PDB Entry: 4hcl (more details), 1.8 Å

PDB Description: crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-lyxarohydroxamate
PDB Compounds: (B:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4hclb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hclb1 d.54.1.0 (B:1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
ykligg

SCOPe Domain Coordinates for d4hclb1:

Click to download the PDB-style file with coordinates for d4hclb1.
(The format of our PDB-style files is described here.)

Timeline for d4hclb1: