Lineage for d4hchb1 (4hch B:-1-126)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905251Species Agrobacterium tumefaciens [TaxId:176299] [226505] (6 PDB entries)
  8. 1905254Domain d4hchb1: 4hch B:-1-126 [222500]
    Other proteins in same PDB: d4hcha2, d4hchb2
    automated match to d1rvka2
    complexed with edo, gol, mg, na, pge, tla

Details for d4hchb1

PDB Entry: 4hch (more details), 1.7 Å

PDB Description: crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-tartrate
PDB Compounds: (B:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4hchb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hchb1 d.54.1.0 (B:-1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
pvykligg

SCOPe Domain Coordinates for d4hchb1:

Click to download the PDB-style file with coordinates for d4hchb1.
(The format of our PDB-style files is described here.)

Timeline for d4hchb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hchb2