Lineage for d4hc1n2 (4hc1 N:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752950Domain d4hc1n2: 4hc1 N:108-213 [222497]
    Other proteins in same PDB: d4hc1a1, d4hc1a2, d4hc1a3, d4hc1b1, d4hc1b2, d4hc1b3, d4hc1h_, d4hc1l1, d4hc1m_, d4hc1n1
    automated match to d1c12a2
    complexed with nag; mutant

Details for d4hc1n2

PDB Entry: 4hc1 (more details), 2.87 Å

PDB Description: crystal structure of a loop deleted mutant of human madcam-1 d1d2 complexed with fab 10g3
PDB Compounds: (N:) 10G3 light chain

SCOPe Domain Sequences for d4hc1n2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hc1n2 b.1.1.2 (N:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4hc1n2:

Click to download the PDB-style file with coordinates for d4hc1n2.
(The format of our PDB-style files is described here.)

Timeline for d4hc1n2: