| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein automated matches [190803] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries) |
| Domain d4hc1a2: 4hc1 A:91-202 [222491] Other proteins in same PDB: d4hc1a1, d4hc1a3, d4hc1b1, d4hc1b3, d4hc1h_, d4hc1l1, d4hc1l2, d4hc1m_, d4hc1n1, d4hc1n2 automated match to d1bqsa2 complexed with nag; mutant |
PDB Entry: 4hc1 (more details), 2.87 Å
SCOPe Domain Sequences for d4hc1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hc1a2 b.1.1.4 (A:91-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqqep
iggdvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvl
Timeline for d4hc1a2: