SCOPe 2.03: Domain d4hbqb1: 4hbq B:1-90

Lineage for d4hbqb1 (4hbq B:1-90)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d4hbqb1: 4hbq B:1-90 [222486]
   Other proteins in same PDB: d4hbqa2, d4hbqb2
   automated match to d1gsma1
   complexed with gol, nag, so4; mutant

Details for d4hbqb1

PDB Entry: 4hbq, 1.4 Å

PDB Description: crystal structure of a loop deleted mutant of human madcam-1 d1d2

PDB Compounds: (B:) Mucosal addressin cell adhesion molecule 1

SCOPe Domain Sequences for d4hbqb1:

Sequence; same for both SEQRES and ATOM records:

>d4hbqb1 b.1.1.0 (B:1-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
naslsaagtrvcvgscggrtfqhtvqllvy

Timeline for d4hbqb1:

• d4hbqb1 is new in SCOPe 2.03-stable
  
• d4hbqb1 appears in SCOPe 2.04
  
• d4hbqb1 appears in the current release, SCOPe 2.08