Lineage for d4hbqb1 (4hbq B:1-90)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754433Domain d4hbqb1: 4hbq B:1-90 [222486]
    Other proteins in same PDB: d4hbqa2, d4hbqa3, d4hbqb2, d4hbqb3
    automated match to d1gsma1
    complexed with gol, nag, so4; mutant

Details for d4hbqb1

PDB Entry: 4hbq (more details), 1.4 Å

PDB Description: crystal structure of a loop deleted mutant of human madcam-1 d1d2
PDB Compounds: (B:) Mucosal addressin cell adhesion molecule 1

SCOPe Domain Sequences for d4hbqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hbqb1 b.1.1.0 (B:1-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
naslsaagtrvcvgscggrtfqhtvqllvy

SCOPe Domain Coordinates for d4hbqb1:

Click to download the PDB-style file with coordinates for d4hbqb1.
(The format of our PDB-style files is described here.)

Timeline for d4hbqb1: