SCOPe 2.06: Domain d4hbld1: 4hbl D:1-146

Lineage for d4hbld1 (4hbl D:1-146)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Staphylococcus epidermidis [TaxId:176279] [226549] (1 PDB entry)

8. Domain d4hbld1: 4hbl D:1-146 [222483]
   Other proteins in same PDB: d4hbla2, d4hblb2, d4hblc2, d4hbld2
   automated match to d1jgsa_

Details for d4hbld1

PDB Entry: 4hbl, 2.5 Å

PDB Description: Crystal structure of AbfR of Staphylococcus epidermidis

PDB Compounds: (D:) transcriptional regulator, MarR family

SCOPe Domain Sequences for d4hbld1:

Sequence; same for both SEQRES and ATOM records:

>d4hbld1 a.4.5.0 (D:1-146) automated matches {Staphylococcus epidermidis [TaxId: 176279]}
mkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlnsigr
hldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpqe
fdtteydetkyvfeeleqtlkhliek

Timeline for d4hbld1:

• d4hbld1 first appeared in SCOPe 2.03, called d4hbld_
  
• d4hbld1 was called d4hbld_ in SCOPe 2.05
  
• d4hbld1 appears in SCOPe 2.07
  
• d4hbld1 appears in the current release, SCOPe 2.08