Lineage for d4hbld_ (4hbl D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480250Species Staphylococcus epidermidis [TaxId:176279] [226549] (1 PDB entry)
  8. 1480254Domain d4hbld_: 4hbl D: [222483]
    automated match to d1jgsa_

Details for d4hbld_

PDB Entry: 4hbl (more details), 2.5 Å

PDB Description: Crystal structure of AbfR of Staphylococcus epidermidis
PDB Compounds: (D:) transcriptional regulator, MarR family

SCOPe Domain Sequences for d4hbld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hbld_ a.4.5.0 (D:) automated matches {Staphylococcus epidermidis [TaxId: 176279]}
amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlnsig
rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpq
efdtteydetkyvfeeleqtlkhliek

SCOPe Domain Coordinates for d4hbld_:

Click to download the PDB-style file with coordinates for d4hbld_.
(The format of our PDB-style files is described here.)

Timeline for d4hbld_: