Lineage for d4hbld1 (4hbl D:1-146)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695105Species Staphylococcus epidermidis [TaxId:176279] [226549] (1 PDB entry)
  8. 2695109Domain d4hbld1: 4hbl D:1-146 [222483]
    Other proteins in same PDB: d4hbla2, d4hblb2, d4hblc2, d4hbld2
    automated match to d1jgsa_

Details for d4hbld1

PDB Entry: 4hbl (more details), 2.5 Å

PDB Description: Crystal structure of AbfR of Staphylococcus epidermidis
PDB Compounds: (D:) transcriptional regulator, MarR family

SCOPe Domain Sequences for d4hbld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hbld1 a.4.5.0 (D:1-146) automated matches {Staphylococcus epidermidis [TaxId: 176279]}
mkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlnsigr
hldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpqe
fdtteydetkyvfeeleqtlkhliek

SCOPe Domain Coordinates for d4hbld1:

Click to download the PDB-style file with coordinates for d4hbld1.
(The format of our PDB-style files is described here.)

Timeline for d4hbld1: