| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Staphylococcus epidermidis [TaxId:176279] [226549] (1 PDB entry) |
| Domain d4hbld1: 4hbl D:1-146 [222483] Other proteins in same PDB: d4hbla2, d4hblb2, d4hblc2, d4hbld2 automated match to d1jgsa_ |
PDB Entry: 4hbl (more details), 2.5 Å
SCOPe Domain Sequences for d4hbld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hbld1 a.4.5.0 (D:1-146) automated matches {Staphylococcus epidermidis [TaxId: 176279]}
mkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlnsigr
hldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpqe
fdtteydetkyvfeeleqtlkhliek
Timeline for d4hbld1: