SCOPe 2.08: Domain d4hblb1: 4hbl B:1-144

Lineage for d4hblb1 (4hbl B:1-144)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Staphylococcus epidermidis [TaxId:176279] [226549] (1 PDB entry)

8. Domain d4hblb1: 4hbl B:1-144 [222481]
   Other proteins in same PDB: d4hbla2, d4hblb2, d4hblc2, d4hbld2
   automated match to d1jgsa_

Details for d4hblb1

PDB Entry: 4hbl, 2.5 Å

PDB Description: Crystal structure of AbfR of Staphylococcus epidermidis

PDB Compounds: (B:) transcriptional regulator, MarR family

SCOPe Domain Sequences for d4hblb1:

Sequence, based on SEQRES records:

>d4hblb1 a.4.5.0 (B:1-144) automated matches {Staphylococcus epidermidis [TaxId: 176279]}
mkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlnsigr
hldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpqe
fdtteydetkyvfeeleqtlkhli

Sequence, based on observed residues (ATOM records):

>d4hblb1 a.4.5.0 (B:1-144) automated matches {Staphylococcus epidermidis [TaxId: 176279]}
mkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvmltlweenpqtlnsigr
hldlssntltpmlkrleqsgwvkrerqqliitltdngqqqqeavfeaissclpqefdtte
ydetkyvfeeleqtlkhli

Timeline for d4hblb1:

• d4hblb1 first appeared in SCOPe 2.03, called d4hblb_
  
• d4hblb1 appears in SCOPe 2.07