Lineage for d4hbka_ (4hbk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081479Species Schistosoma japonicum [TaxId:6182] [226697] (1 PDB entry)
  8. 2081480Domain d4hbka_: 4hbk A: [222479]
    automated match to d3ntya_

Details for d4hbka_

PDB Entry: 4hbk (more details), 2.2 Å

PDB Description: Structure of the Aldose Reductase from Schistosoma japonicum
PDB Compounds: (A:) Aldo-keto reductase family 1, member B4 (Aldose reductase)

SCOPe Domain Sequences for d4hbka_:

Sequence, based on SEQRES records: (download)

>d4hbka_ c.1.7.0 (A:) automated matches {Schistosoma japonicum [TaxId: 6182]}
meplkmnngrsipviglgtwnsppgevgaavkkaleigyrhldcayvyrneaeigealen
alnslrlkredifitsklwntffrpehvrkaceetlknlrlnyldlylihwpvplkhggd
lfptdsngqlcldnvphedtwkemeklvdeglvksiglsnfnkrqiqnilehcrikpanl
qieihanfpniklveyaqsvgltvtayaplgspahspgkvnlltkpcvleiahrhkktpa
qvllryllqrklivvpksvtfkrieenfqvfdfqlsneemhelnteslnerqftllqmsg
hqeypfkeey

Sequence, based on observed residues (ATOM records): (download)

>d4hbka_ c.1.7.0 (A:) automated matches {Schistosoma japonicum [TaxId: 6182]}
meplkmnngrsipviglgtwnsppgevgaavkkaleigyrhldcayvyrneaeigealen
alnslrlkredifitsklwntffrpehvrkaceetlknlrlnyldlylihwpvplkhggd
lfptdsngqlcldnvphedtwkemeklvdeglvksiglsnfnkrqiqnilehcrikpanl
qieihanfpniklveyaqsvgltvtayaplgnlltkpcvleiahrhkktpaqvllryllq
rklivvpksvtfkrieenfqvfdfqlsneemhelnteslnerqftllqmsghqeypfkee
y

SCOPe Domain Coordinates for d4hbka_:

Click to download the PDB-style file with coordinates for d4hbka_.
(The format of our PDB-style files is described here.)

Timeline for d4hbka_: