SCOPe 2.04: Domain d4hbcl2: 4hbc L:117-213

Lineage for d4hbcl2 (4hbc L:117-213)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (12 PDB entries)

8. Domain d4hbcl2: 4hbc L:117-213 [222478]
   automated match to d1a3rl2
   complexed with so4

Details for d4hbcl2

PDB Entry: 4hbc, 1.54 Å

PDB Description: Crystal structure of a conformation-dependent rabbit IgG Fab specific for amyloid prefibrillar oligomers

PDB Compounds: (L:) Antigen Binding Fragment, Immunoglobulin IgG - Light Chain

SCOPe Domain Sequences for d4hbcl2:

Sequence; same for both SEQRES and ATOM records:

>d4hbcl2 b.1.1.0 (L:117-213) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vlifppsadlvatgtvtivcvankyfpdvtvtwevdgttqttgiensktpqnsadctynl
sstltltsteynshkeytckvtqgttsvvqsfnrgdc

Timeline for d4hbcl2:

• d4hbcl2 first appeared in SCOPe 2.03
  
• d4hbcl2 appears in SCOPe 2.05
  
• d4hbcl2 appears in the current release, SCOPe 2.08