SCOPe 2.06: Domain d4hb0b_: 4hb0 B:

Lineage for d4hb0b_ (4hb0 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (31 PDB entries)

8. Domain d4hb0b_: 4hb0 B: [222472]
   Other proteins in same PDB: d4hb0a_
   automated match to d4hb3b_
   complexed with cl, gnp, lbf, mg

Details for d4hb0b_

PDB Entry: 4hb0, 2.2 Å

PDB Description: crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k541q,k542q,r543s,k545q,k548q,k579q)-ran-ranbp1

PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d4hb0b_:

Sequence; same for both SEQRES and ATOM records:

>d4hb0b_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eedeevlykvraklfrfdkdakewkergtgdckflknkktnkvrilmrrdktlkicanhi
iapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqeink
k

Timeline for d4hb0b_:

• d4hb0b_ first appeared in SCOPe 2.03
  
• d4hb0b_ appears in SCOPe 2.05
  
• d4hb0b_ appears in SCOPe 2.07
  
• d4hb0b_ appears in the current release, SCOPe 2.08