SCOPe 2.08: Domain d1azva_: 1azv A:

Lineage for d1azva_ (1azv A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries)

8. Domain d1azva_: 1azv A: [22247]
   complexed with cu, zn; mutant

Details for d1azva_

PDB Entry: 1azv, 1.9 Å

PDB Description: familial als mutant g37r cuznsod (human)

PDB Compounds: (A:) copper/zinc superoxide dismutase

SCOPe Domain Sequences for d1azva_:

Sequence; same for both SEQRES and ATOM records:

>d1azva_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikrlteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Timeline for d1azva_:

• d1azva_ first appeared (with stable ids) in SCOP 1.55
  
• d1azva_ appears in SCOPe 2.07