SCOPe 2.05: Domain d4hayb_: 4hay B:

Lineage for d4hayb_ (4hay B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (21 PDB entries)

8. Domain d4hayb_: 4hay B: [222468]
   Other proteins in same PDB: d4haya_
   automated match to d4hb3b_
   complexed with cl, edo, gnp, lmb, mg

Details for d4hayb_

PDB Entry: 4hay, 2.3 Å

PDB Description: crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548e,k579q)-ran-ranbp1

PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d4hayb_:

Sequence; same for both SEQRES and ATOM records:

>d4hayb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eedeevlykvraklfrfdkdakewkergtgdckflknkktnkvrilmrrdktlkicanhi
iapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqeink
k

Timeline for d4hayb_:

• d4hayb_ first appeared in SCOPe 2.03
  
• d4hayb_ appears in SCOPe 2.04
  
• d4hayb_ appears in SCOPe 2.06
  
• d4hayb_ appears in the current release, SCOPe 2.08