SCOPe 2.03: Domain d4havb_: 4hav B:

Lineage for d4havb_ (4hav B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (13 PDB entries)

8. Domain d4havb_: 4hav B: [222462]
   Other proteins in same PDB: d4hava_
   automated match to d4hb3b_
   complexed with aa8, cl, gnp, mg

Details for d4havb_

PDB Entry: 4hav, 2 Å

PDB Description: crystal structure of crm1 inhibitor anguinomycin a in complex with crm1-ran-ranbp1

PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d4havb_:

Sequence, based on SEQRES records:

>d4havb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvhlekvdvktmeedeevlykvraklfrfdkdakewkergtgdckflknkktnkv
rilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgske
nadkfkeefekaqeinkk

Sequence, based on observed residues (ATOM records):

>d4havb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvktmeedeevlykvraklfrfdkdakewkergtgdckflknkktnkvrilmrrd
ktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfke
efekaqeinkk

Timeline for d4havb_:

• d4havb_ is new in SCOPe 2.03-stable
  
• d4havb_ appears in SCOPe 2.04
  
• d4havb_ appears in the current release, SCOPe 2.08