Lineage for d4haqa1 (4haq A:24-453)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779993Protein automated matches [190170] (17 species)
    not a true protein
  7. 2780034Species Limnoria quadripunctata [TaxId:161573] [197311] (4 PDB entries)
  8. 2780040Domain d4haqa1: 4haq A:24-453 [222455]
    Other proteins in same PDB: d4haqa2, d4haqb2
    automated match to d4hapb_
    complexed with ca, mg, trs

Details for d4haqa1

PDB Entry: 4haq (more details), 1.9 Å

PDB Description: crystal structure of a gh7 family cellobiohydrolase from limnoria quadripunctata in complex with cellobiose and cellotriose
PDB Compounds: (A:) GH7 family protein

SCOPe Domain Sequences for d4haqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4haqa1 b.29.1.10 (A:24-453) automated matches {Limnoria quadripunctata [TaxId: 161573]}
qagteteeyhlpltwerdgssvsasvvidsnwrwthstedttncydgnewdstlcpdadt
ctencaidgvdqgtwgdtygitasgskltlsfvtegeystdigsrvflmadddnyeifnl
ldkefsfdvdasnlpcglngalyfvsmdedggtskystntagakygtgycdaqcphdmkf
iagkansdgwtpsdndqnagtgemgacchemdiweansqaqsytahvcsvdgytpctgtd
cgdngddrykgvcdkdgcdyaayrlgqhdfygeggtvdsgstltvitqfitgggglneir
riyqqggqtiqnaavnfpgdvdpydsitedfcvdikryfgdtndfdakggmsgmsnalkk
gmvlvmslwddhyanmlwldatypvdstepgalrgpcstdsgdpadveanfpgstvtfsn
ikigpiqsyd

SCOPe Domain Coordinates for d4haqa1:

Click to download the PDB-style file with coordinates for d4haqa1.
(The format of our PDB-style files is described here.)

Timeline for d4haqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4haqa2