SCOPe 2.03: Domain d4ha5a_: 4ha5 A:

Lineage for d4ha5a_ (4ha5 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein beta-secretase (memapsin) [50671] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50672] (229 PDB entries)
   Uniprot P56817 58-446 ! Uniprot P56817 60-447

8. Domain d4ha5a_: 4ha5 A: [222451]
   automated match to d3l5ea_
   complexed with 13w, tla

Details for d4ha5a_

PDB Entry: 4ha5, 1.83 Å

PDB Description: Structure of BACE Bound to (S)-3-(5-(2-imino-1,4-dimethyl-6-oxohexahydropyrimidin-4-yl)thiophen-3-yl)benzonitrile

PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d4ha5a_:

Sequence; same for both SEQRES and ATOM records:

>d4ha5a_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyni

Timeline for d4ha5a_:

• d4ha5a_ is new in SCOPe 2.03-stable
  
• d4ha5a_ appears in SCOPe 2.04
  
• d4ha5a_ appears in the current release, SCOPe 2.08