SCOPe 2.06: Domain d4h82d_: 4h82 D:

Lineage for d4h82d_ (4h82 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Gelatinase B (MMP-9) [75496] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75497] (16 PDB entries)

8. Domain d4h82d_: 4h82 D: [222429]
   automated match to d4h1qb_
   complexed with ca, gol, l29, peg, pgo, ppi, zn; mutant

Details for d4h82d_

PDB Entry: 4h82, 1.9 Å

PDB Description: crystal structure of mutant mmp-9 catalytic domain in complex with a twin inhibitor.

PDB Compounds: (D:) Matrix metalloproteinase-9

SCOPe Domain Sequences for d4h82d_:

Sequence; same for both SEQRES and ATOM records:

>d4h82d_ d.92.1.11 (D:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhlyg

Timeline for d4h82d_:

• d4h82d_ first appeared in SCOPe 2.03
  
• d4h82d_ appears in SCOPe 2.05
  
• d4h82d_ appears in SCOPe 2.07
  
• d4h82d_ appears in the current release, SCOPe 2.08