Lineage for d4h82d_ (4h82 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964375Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 2964376Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries)
  8. 2964396Domain d4h82d_: 4h82 D: [222429]
    automated match to d4h1qb_
    complexed with ca, gol, l29, peg, pgo, ppi, zn; mutant

Details for d4h82d_

PDB Entry: 4h82 (more details), 1.9 Å

PDB Description: crystal structure of mutant mmp-9 catalytic domain in complex with a twin inhibitor.
PDB Compounds: (D:) Matrix metalloproteinase-9

SCOPe Domain Sequences for d4h82d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h82d_ d.92.1.11 (D:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhlyg

SCOPe Domain Coordinates for d4h82d_:

Click to download the PDB-style file with coordinates for d4h82d_.
(The format of our PDB-style files is described here.)

Timeline for d4h82d_: