| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
| Protein Gelatinase B (MMP-9) [75496] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [75497] (16 PDB entries) |
| Domain d4h82b_: 4h82 B: [222427] automated match to d4h1qb_ complexed with ca, gol, l29, peg, pgo, ppi, zn; mutant |
PDB Entry: 4h82 (more details), 1.9 Å
SCOPe Domain Sequences for d4h82b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h82b_ d.92.1.11 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhlyg
Timeline for d4h82b_: