SCOP 1.73: Domain d2sodb_: 2sod B:

Lineage for d2sodb_ (2sod B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (17 PDB entries)

8. Domain d2sodb_: 2sod B: [22242]

Details for d2sodb_

PDB Entry: 2sod, 2 Å

PDB Description: determination and analysis of the 2 angstrom structure of copper, zinc superoxide dismutase

PDB Compounds: (B:) Copper,Zinc Superoxide Dismutase

SCOP Domain Sequences for d2sodb_:

Sequence; same for both SEQRES and ATOM records:

>d2sodb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d2sodb_:

• d2sodb_ first appeared (with stable ids) in SCOP 1.55
  
• d2sodb_ appears in SCOP 1.71
  
• d2sodb_ appears in SCOP 1.75
  
• d2sodb_ appears in the current release, SCOPe 2.08