Class b: All beta proteins [48724] (177 folds) |
Fold b.159: AOC barrel-like [141492] (2 superfamilies) barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds |
Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) |
Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins) Pfam PF06351 |
Protein automated matches [190385] (2 species) not a true protein |
Species Physcomitrella patens [TaxId:3218] [193452] (2 PDB entries) |
Domain d4h6ci_: 4h6c I: [222413] automated match to d4h6bb_ complexed with hez, po4 |
PDB Entry: 4h6c (more details), 1.35 Å
SCOPe Domain Sequences for d4h6ci_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h6ci_ b.159.1.1 (I:) automated matches {Physcomitrella patens [TaxId: 3218]} hvqelfvyeinerdrgspvflpfggkkqpgtdahvnslgdlvpfsnkiydgslktrlgit aglctlishsdqkngdryealysfyfgdyghisvqgpyityedsylaitggsgifagcyg qaklhqiifpfklfytfylqgikklpealcapcvppspsvapadeakqclpnhvapnftk
Timeline for d4h6ci_: