SCOPe 2.05: Domain d4h69e_: 4h69 E:

Lineage for d4h69e_ (4h69 E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.159: AOC barrel-like [141492] (2 superfamilies)
   barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds

4. Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families)

5. Family b.159.1.0: automated matches [193448] (1 protein)
   not a true family

6. Protein automated matches [193449] (1 species)
   not a true protein

7. Species Physcomitrella patens [TaxId:145481] [193450] (2 PDB entries)

8. Domain d4h69e_: 4h69 E: [222403]
   automated match to d4h6ab_
   complexed with 10y, ipa, po4

Details for d4h69e_

PDB Entry: 4h69, 2 Å

PDB Description: crystal structure of the allene oxide cyclase 2 from physcomitrella patens complexed with substrate analog

PDB Compounds: (E:) allene oxide cyclase

SCOPe Domain Sequences for d4h69e_:

Sequence; same for both SEQRES and ATOM records:

>d4h69e_ b.159.1.0 (E:) automated matches {Physcomitrella patens [TaxId: 145481]}
gplgsmgnkvdklagvqelsvyeinerdrgspvilpfggkkdengahanslgdlvpfsnk
vydgslqrrlgitagictlishnaekkgdryeaqysfyfgdyghisvqgpyityedtelv
vtggtgifagchgvaklhqiifpvklfytfylqgikklpeelcasvvppspsaepseqak
kchpssvapnftn

Timeline for d4h69e_:

• d4h69e_ first appeared in SCOPe 2.03
  
• d4h69e_ appears in SCOPe 2.04
  
• d4h69e_ is called d4h69e1 in SCOPe 2.06
  
• d4h69e_ appears in the current release, SCOPe 2.08, called d4h69e1