![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
![]() | Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries) |
![]() | Domain d1sdao_: 1sda O: [22240] complexed with cu, zn |
PDB Entry: 1sda (more details), 2.5 Å
SCOPe Domain Sequences for d1sdao_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sdao_ b.1.8.1 (O:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]} atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek pddlgrggneestktgnagsrlacgvigiak
Timeline for d1sdao_: