Lineage for d4h5xa1 (4h5x A:372-500)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613471Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 2613472Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 2613484Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
    duplication: consists of two polo-box domains; binds phosphothreonine peptide
  6. 2613485Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)
  7. 2613486Species Human (Homo sapiens) [TaxId:9606] [102858] (28 PDB entries)
  8. 2613517Domain d4h5xa1: 4h5x A:372-500 [222394]
    automated match to d3bzia1
    complexed with gol

Details for d4h5xa1

PDB Entry: 4h5x (more details), 1.95 Å

PDB Description: human Plk1-PBD with a glycerol bound at the phophopeptide binding site
PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d4h5xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h5xa1 d.223.1.2 (A:372-500) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
chlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdns
vgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehll
kaganitpr

SCOPe Domain Coordinates for d4h5xa1:

Click to download the PDB-style file with coordinates for d4h5xa1.
(The format of our PDB-style files is described here.)

Timeline for d4h5xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h5xa2