SCOPe 2.07: Domain d4h5gb_: 4h5g B:

Lineage for d4h5gb_ (4h5g B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:637987] [193477] (7 PDB entries)

8. Domain d4h5gb_: 4h5g B: [222393]
   automated match to d4h5fc_
   complexed with act, arg, edo, gol, peg, so4

Details for d4h5gb_

PDB Entry: 4h5g, 1.78 Å

PDB Description: Crystal structure of an amino acid ABC transporter substrate-binding protein from Streptococcus pneumoniae Canada MDR_19A bound to L-arginine, form 2

PDB Compounds: (B:) Amino acid ABC superfamily ATP binding cassette transporter, binding protein

SCOPe Domain Sequences for d4h5gb_:

Sequence; same for both SEQRES and ATOM records:

>d4h5gb_ c.94.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}
qsaveaikqkgklvvatspdyapfefqslvdgknqvvgadidmaqaiadelgvkleilsm
sfdnvltslqtgkadlavagisatderkevfdfsipyyenkisflvhkadvekykdltsl
esaniaaqkgtvpesmvkeqlpkaqltsltnmgeavnelqagkidavhmdepvalsyaak
naglavatvslkmkdgdanavalrknsddlkevvdkviqklkdegtyqsylekaasltev

Timeline for d4h5gb_:

• d4h5gb_ first appeared in SCOPe 2.03
  
• d4h5gb_ appears in SCOPe 2.06
  
• d4h5gb_ appears in the current release, SCOPe 2.08