SCOPe 2.07: Domain d4h5ef_: 4h5e F:

Lineage for d4h5ef_ (4h5e F:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein automated matches [190489] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187688] (85 PDB entries)

8. Domain d4h5ef_: 4h5e F: [222391]
   automated match to d2f89f_
   complexed with ipr, mg, ys4

Details for d4h5ef_

PDB Entry: 4h5e, 2.04 Å

PDB Description: Crystal structure of human FPPS in ternary complex with YS0470 and isopentenyl pyrophosphate

PDB Compounds: (F:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4h5ef_:

Sequence; same for both SEQRES and ATOM records:

>d4h5ef_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk

Timeline for d4h5ef_:

• d4h5ef_ first appeared in SCOPe 2.03
  
• d4h5ef_ appears in SCOPe 2.06
  
• d4h5ef_ appears in the current release, SCOPe 2.08