Lineage for d1sdag_ (1sda G:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291100Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 291101Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 291114Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 291143Species Cow (Bos taurus) [TaxId:9913] [49332] (15 PDB entries)
  8. 291170Domain d1sdag_: 1sda G: [22239]

Details for d1sdag_

PDB Entry: 1sda (more details), 2.5 Å

PDB Description: crystal structure of peroxynitrite-modified bovine cu,zn superoxide dismutase

SCOP Domain Sequences for d1sdag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sdag_ b.1.8.1 (G:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOP Domain Coordinates for d1sdag_:

Click to download the PDB-style file with coordinates for d1sdag_.
(The format of our PDB-style files is described here.)

Timeline for d1sdag_: