Lineage for d4h51a_ (4h51 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132619Species Leishmania major [TaxId:347515] [226494] (1 PDB entry)
  8. 2132620Domain d4h51a_: 4h51 A: [222387]
    automated match to d7aata_
    complexed with edo

Details for d4h51a_

PDB Entry: 4h51 (more details), 1.85 Å

PDB Description: crystal structure of a putative aspartate aminotransferase from leishmania major friedlin
PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d4h51a_:

Sequence, based on SEQRES records: (download)

>d4h51a_ c.67.1.0 (A:) automated matches {Leishmania major [TaxId: 347515]}
mttaerwqkiqaqapdvifdlakraaaakgpkanlvigayrdeqgrpyplrvvrkaeqll
ldmnldyeylpisgyqpfideavkiiygntvelenlvavqtlsgtgavslgaklltrvfd
aettpiylsdptwpnhygvvkaagwknictyayydpktvslnfegmkkdilaapdgsvfi
lhqcahnptgvdpsqeqwneiaslmlakhhqvffdsayqgyasgsldtdayaarlfarrg
ievllaqsfsknmglyseragtlslllkdktkradvksvmdslireeytcppahgarlah
lilsnnelrkeweaelsamaerirtmrrtvydellrlqtpgswehvinqigmfsflglsk
aqceycqnhnifitvsgranmaglthetalmlaqtindavr

Sequence, based on observed residues (ATOM records): (download)

>d4h51a_ c.67.1.0 (A:) automated matches {Leishmania major [TaxId: 347515]}
mttaerwqkiqaqapdvifdlakraaaakgpkanlvigayrdeqgrpyplrvvrkaeqll
ldmnldyeylpisgyqpfideavkiiygelenlvavqtlsgtgavslgaklltrvfdaet
tpiylsdptwpnhygvvkaagwknictyayydpktvslnfegmkkdilaapdgsvfilhq
cahnptgvdpsqeqwneiaslmlakhhqvffdsayqgyasgsldtdayaarlfarrgiev
llaqsfsknmglyseragtlslllkdktkradvksvmdslireeytcppahgarlahlil
snnelrkeweaelsamaerirtmrrtvydellrlqtpgswehvinqigmfsflglskaqc
eycqnhnifitvsgranmaglthetalmlaqtindavr

SCOPe Domain Coordinates for d4h51a_:

Click to download the PDB-style file with coordinates for d4h51a_.
(The format of our PDB-style files is described here.)

Timeline for d4h51a_: