Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein automated matches [190211] (5 species) not a true protein |
Species Human immunodeficiency virus type 1 [TaxId:11678] [226272] (12 PDB entries) |
Domain d4h4mb_: 4h4m B: [222383] Other proteins in same PDB: d4h4ma2 automated match to d1hqeb_ complexed with 494, edo |
PDB Entry: 4h4m (more details), 2.85 Å
SCOPe Domain Sequences for d4h4mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h4mb_ e.8.1.2 (B:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]} pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp plvklwyq
Timeline for d4h4mb_: