Lineage for d1sdab_ (1sda B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373677Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2373678Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2373698Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2373739Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)
  8. 2373788Domain d1sdab_: 1sda B: [22238]
    complexed with cu, zn

Details for d1sdab_

PDB Entry: 1sda (more details), 2.5 Å

PDB Description: crystal structure of peroxynitrite-modified bovine cu,zn superoxide dismutase
PDB Compounds: (B:) Copper,Zinc Superoxide Dismutase

SCOPe Domain Sequences for d1sdab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sdab_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOPe Domain Coordinates for d1sdab_:

Click to download the PDB-style file with coordinates for d1sdab_.
(The format of our PDB-style files is described here.)

Timeline for d1sdab_: