SCOPe 2.05: Domain d4h3gb_: 4h3g B:

Lineage for d4h3gb_ (4h3g B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein beta-secretase (memapsin) [50671] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50672] (258 PDB entries)
   Uniprot P56817 58-446 ! Uniprot P56817 60-447

8. Domain d4h3gb_: 4h3g B: [222376]
   automated match to d3l5ea_
   complexed with 10q, tla

Details for d4h3gb_

PDB Entry: 4h3g, 1.85 Å

PDB Description: Structure of BACE Bound to 2-((7aR)-7a-(4-(3-cyanophenyl)thiophen-2-yl)-2-imino-3-methyl-4-oxohexahydro-1H-pyrrolo[3,4-d]pyrimidin-6(2H)-yl)nicotinonitrile

PDB Compounds: (B:) Beta-secretase 1

SCOPe Domain Sequences for d4h3gb_:

Sequence; same for both SEQRES and ATOM records:

>d4h3gb_ b.50.1.2 (B:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

Timeline for d4h3gb_:

• d4h3gb_ first appeared in SCOPe 2.03
  
• d4h3gb_ appears in SCOPe 2.04
  
• d4h3gb_ appears in SCOPe 2.06
  
• d4h3gb_ appears in the current release, SCOPe 2.08