Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (37 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [226483] (2 PDB entries) |
Domain d4h3ea2: 4h3e A:120-233 [222370] Other proteins in same PDB: d4h3ea1, d4h3eb1 automated match to d1jr9a2 complexed with fe2 |
PDB Entry: 4h3e (more details), 2.25 Å
SCOPe Domain Sequences for d4h3ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h3ea2 d.44.1.0 (A:120-233) automated matches {Trypanosoma cruzi [TaxId: 353153]} ngkampksfesavtaqfgsveqfkdafvqagvnnfgsgwtwlcvdpsnknqlvidntsna gcpltkglrpvlavdvwehayykdfenrrpdylkeiwsvidwefvakmhaqaik
Timeline for d4h3ea2: