Lineage for d4h3ea2 (4h3e A:120-233)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903858Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1903859Protein automated matches [226860] (30 species)
    not a true protein
  7. 1904006Species Trypanosoma cruzi [TaxId:353153] [226483] (2 PDB entries)
  8. 1904007Domain d4h3ea2: 4h3e A:120-233 [222370]
    Other proteins in same PDB: d4h3ea1, d4h3eb1
    automated match to d1jr9a2
    complexed with fe2

Details for d4h3ea2

PDB Entry: 4h3e (more details), 2.25 Å

PDB Description: crystal structure of a putative iron superoxide dismutase from trypanosoma cruzi bound to iron
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4h3ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h3ea2 d.44.1.0 (A:120-233) automated matches {Trypanosoma cruzi [TaxId: 353153]}
ngkampksfesavtaqfgsveqfkdafvqagvnnfgsgwtwlcvdpsnknqlvidntsna
gcpltkglrpvlavdvwehayykdfenrrpdylkeiwsvidwefvakmhaqaik

SCOPe Domain Coordinates for d4h3ea2:

Click to download the PDB-style file with coordinates for d4h3ea2.
(The format of our PDB-style files is described here.)

Timeline for d4h3ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h3ea1