Lineage for d1cb4b_ (1cb4 B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10106Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 10107Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 10118Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 10136Species Cow (Bos taurus) [TaxId:9913] [49332] (15 PDB entries)
  8. 10161Domain d1cb4b_: 1cb4 B: [22237]

Details for d1cb4b_

PDB Entry: 1cb4 (more details), 2.3 Å

PDB Description: crystal structure of copper, zinc superoxide dismutase

SCOP Domain Sequences for d1cb4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb4b_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdderhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOP Domain Coordinates for d1cb4b_:

Click to download the PDB-style file with coordinates for d1cb4b_.
(The format of our PDB-style files is described here.)

Timeline for d1cb4b_: