SCOPe 2.07: Domain d4h3aa_: 4h3a A:

Lineage for d4h3aa_ (4h3a A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
   automatically mapped to Pfam PF01255

6. Protein Undecaprenyl diphosphate synthase [64007] (3 species)

7. Species Escherichia coli [TaxId:562] [64009] (17 PDB entries)

8. Domain d4h3aa_: 4h3a A: [222365]
   automated match to d1ueha_
   complexed with 0yy

Details for d4h3aa_

PDB Entry: 4h3a, 1.98 Å

PDB Description: Structure of E. coli undecaprenyl diphosphate synthase in complex with BPH-1330

PDB Compounds: (A:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d4h3aa_:

Sequence, based on SEQRES records:

>d4h3aa_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
ahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssen
wnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagn
tgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvir
tggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr

Sequence, based on observed residues (ATOM records):

>d4h3aa_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
ahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyaflfvw
aldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdi
vqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiay
aelyftdvlwpdfdeqdfegalnafanr

Timeline for d4h3aa_:

• d4h3aa_ first appeared in SCOPe 2.03
  
• d4h3aa_ appears in SCOPe 2.06
  
• d4h3aa_ appears in the current release, SCOPe 2.08