SCOPe 2.03: Domain d4h32k_: 4h32 K:

Lineage for d4h32k_ (4h32 K:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (6 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)

8. Domain d4h32k_: 4h32 K: [222360]
   automated match to d1rd8a_
   complexed with nag

Details for d4h32k_

PDB Entry: 4h32, 2.7 Å

PDB Description: the crystal structure of the hemagglutinin h17 derived the bat influenza a virus

PDB Compounds: (K:) Hemagglutinin

SCOPe Domain Sequences for d4h32k_:

Sequence; same for both SEQRES and ATOM records:

>d4h32k_ b.19.1.2 (K:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlag
wllgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnp
qsmtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntk
daaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlrie
stgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtign
cpkyvkatslmlatglrnnp

Timeline for d4h32k_:

• d4h32k_ is new in SCOPe 2.03-stable
  
• d4h32k_ appears in SCOPe 2.04
  
• d4h32k_ appears in the current release, SCOPe 2.08, called d4h32k1